Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
Protein automated matches [191055] (20 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [380329] (6 PDB entries) |
Domain d6jf8d_: 6jf8 D: [380386] automated match to d2defa_ complexed with lhy, zn |
PDB Entry: 6jf8 (more details), 1.7 Å
SCOPe Domain Sequences for d6jf8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jf8d_ d.167.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 470]} vvlpvakrgedilkliaapvsanelnsnwlyqladamhatmlerngvgiaapqvyiskrv iivasrpnprypdapemnavvmvnpeilefssemclgeegclsvpdergqveraemvkvk yltlqgemvetvfqgfparivqhevdhlngilfveris
Timeline for d6jf8d_: