SCOPe 2.08: Domain d6h08a1: 6h08 A:4-294

Lineage for d6h08a1 (6h08 A:4-294)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
   Uniprot P00431

8. Domain d6h08a1: 6h08 A:4-294 [380379]
   Other proteins in same PDB: d6h08a2, d6h08b2, d6h08c2
   automated match to d1s73a_
   complexed with co, hem, mn, na

Details for d6h08a1

PDB Entry: 6h08, 1.9 Å

PDB Description: the crystal structure of engineered cytochrome c peroxidase from saccharomyces cerevisiae with a his175me-his proximal ligand substitution

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d6h08a1:

Sequence; same for both SEQRES and ATOM records:

>d6h08a1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d6h08a1:

• d6h08a1 first appeared in SCOPe 2.07