Lineage for d6h08c1 (6h08 C:4-294)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2719985Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2719986Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
    Uniprot P00431
  8. 2720120Domain d6h08c1: 6h08 C:4-294 [380320]
    Other proteins in same PDB: d6h08a2, d6h08b2, d6h08c2
    automated match to d1s73a_
    complexed with co, hem, mn, na

Details for d6h08c1

PDB Entry: 6h08 (more details), 1.9 Å

PDB Description: the crystal structure of engineered cytochrome c peroxidase from saccharomyces cerevisiae with a his175me-his proximal ligand substitution
PDB Compounds: (C:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d6h08c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h08c1 a.93.1.1 (C:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d6h08c1:

Click to download the PDB-style file with coordinates for d6h08c1.
(The format of our PDB-style files is described here.)

Timeline for d6h08c1: