Lineage for d1d6ub2 (1d6u B:91-185)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190011Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 190052Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 190053Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 190054Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 190078Species Escherichia coli [TaxId:562] [54419] (10 PDB entries)
  8. 190109Domain d1d6ub2: 1d6u B:91-185 [38033]
    Other proteins in same PDB: d1d6ua1, d1d6ua4, d1d6ub1, d1d6ub4

Details for d1d6ub2

PDB Entry: 1d6u (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase anaerobically reduced with beta-phenylethylamine

SCOP Domain Sequences for d1d6ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ub2 d.17.2.1 (B:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOP Domain Coordinates for d1d6ub2:

Click to download the PDB-style file with coordinates for d1d6ub2.
(The format of our PDB-style files is described here.)

Timeline for d1d6ub2: