Lineage for d1d6ub1 (1d6u B:301-725)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165117Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 165118Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 165119Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 165132Species Escherichia coli [TaxId:562] [50001] (10 PDB entries)
  8. 165148Domain d1d6ub1: 1d6u B:301-725 [24403]
    Other proteins in same PDB: d1d6ua2, d1d6ua3, d1d6ua4, d1d6ub2, d1d6ub3, d1d6ub4

Details for d1d6ub1

PDB Entry: 1d6u (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase anaerobically reduced with beta-phenylethylamine
PDB Compounds: (B:)

SCOP Domain Sequences for d1d6ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ub1 b.30.2.1 (B:301-725) Copper amine oxidase, domain 3 (catalytic) {Escherichia coli}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkk

SCOP Domain Coordinates for d1d6ub1:

Click to download the PDB-style file with coordinates for d1d6ub1.
(The format of our PDB-style files is described here.)

Timeline for d1d6ub1: