Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.10: Retroviral integrase, N-terminal Zn binding domain [46919] (3 families) |
Family a.4.10.1: HIV/SIV integrase, N-terminal Zn binding domain [46920] (2 proteins) Zn-binding site is near the C-terminus Pfam PF02022 |
Protein Simian immunodeficiency virus [418890] (1 species) not a true protein |
Species Simian immunodeficiency virus [TaxId:11723] [419293] (3 PDB entries) |
Domain d6rwok1: 6rwo K:4-43 [380211] Other proteins in same PDB: d6rwoc2, d6rwod1, d6rwod2, d6rwoe2, d6rwof1, d6rwok2, d6rwol1, d6rwol2, d6rwom2, d6rwon1 automated match to d1k6ya1 protein/DNA complex; complexed with cl, klq, mg, zn |
PDB Entry: 6rwo (more details), 3.05 Å
SCOPe Domain Sequences for d6rwok1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rwok1 a.4.10.1 (K:4-43) Simian immunodeficiency virus {Simian immunodeficiency virus [TaxId: 11723]} giekaqeehekyhnnwramaedfqipqvvakeivaqcpkc
Timeline for d6rwok1: