Lineage for d6rwok1 (6rwo K:4-43)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695622Superfamily a.4.10: Retroviral integrase, N-terminal Zn binding domain [46919] (3 families) (S)
  5. 2695623Family a.4.10.1: HIV/SIV integrase, N-terminal Zn binding domain [46920] (2 proteins)
    Zn-binding site is near the C-terminus
    Pfam PF02022
  6. 2695650Protein Simian immunodeficiency virus [418890] (1 species)
    not a true protein
  7. 2695651Species Simian immunodeficiency virus [TaxId:11723] [419293] (3 PDB entries)
  8. 2695658Domain d6rwok1: 6rwo K:4-43 [380211]
    Other proteins in same PDB: d6rwoc2, d6rwod1, d6rwod2, d6rwoe2, d6rwof1, d6rwok2, d6rwol1, d6rwol2, d6rwom2, d6rwon1
    automated match to d1k6ya1
    protein/DNA complex; complexed with cl, klq, mg, zn

Details for d6rwok1

PDB Entry: 6rwo (more details), 3.05 Å

PDB Description: sivrcm intasome (q148h/g140s) in complex with bictegravir
PDB Compounds: (K:) pol protein

SCOPe Domain Sequences for d6rwok1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rwok1 a.4.10.1 (K:4-43) Simian immunodeficiency virus {Simian immunodeficiency virus [TaxId: 11723]}
giekaqeehekyhnnwramaedfqipqvvakeivaqcpkc

SCOPe Domain Coordinates for d6rwok1:

Click to download the PDB-style file with coordinates for d6rwok1.
(The format of our PDB-style files is described here.)

Timeline for d6rwok1: