SCOP 1.61: Domain d4mon.4: 4mon D:,C:

Lineage for d4mon.4 (4mon D:,C:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.1: Cystatin/monellin [54403] (2 families)

5. Family d.17.1.1: Monellin [54404] (1 protein)

6. Protein Monellin, B & A chains together [54405] (1 species)

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (7 PDB entries)

8. Domain d4mon.4: 4mon D:,C: [37991]

Details for d4mon.4

PDB Entry: 4mon, 2.3 Å

PDB Description: orthorhombic monellin

SCOP Domain Sequences for d4mon.4:

Sequence; same for both SEQRES and ATOM records:

>g4mon.4 d.17.1.1 (D:,C:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq
lyvyasdklfradisedyktrgrkllrfngpvppp

Timeline for d4mon.4:

• d4mon.4 first appeared (with stable ids) in SCOP 1.55
  
• d4mon.4 appears in SCOP 1.59
  
• d4mon.4 appears in SCOP 1.63
  
• d4mon.4 appears in the current release, SCOPe 2.08