Lineage for d4mon.4 (4mon D:,C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2504827Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2504828Family d.17.1.1: Monellin [54404] (2 protein domains)
  6. 2504829Protein Monellin, B & A chains together [54405] (1 species)
  7. 2504830Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries)
  8. 2504836Domain d4mon.4: 4mon D:,C: [37991]

Details for d4mon.4

PDB Entry: 4mon (more details), 2.3 Å

PDB Description: orthorhombic monellin
PDB Compounds: (C:) monellin, (D:) monellin

SCOPe Domain Sequences for d4mon.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g4mon.4 d.17.1.1 (D:,C:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq
lyvyasdklfradisedyktrgrkllrfngpvppp

SCOPe Domain Coordinates for d4mon.4:

Click to download the PDB-style file with coordinates for d4mon.4.
(The format of our PDB-style files is described here.)

Timeline for d4mon.4: