SCOP 1.67: Domain d4mon.3: 4mon B:,A:

Lineage for d4mon.3 (4mon B:,A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (3 families)
   has a additional strand at the N-terminus

5. Family d.17.1.1: Monellin [54404] (1 protein)

6. Protein Monellin, B & A chains together [54405] (1 species)

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (11 PDB entries)

8. Domain d4mon.3: 4mon B:,A: [37990]

Details for d4mon.3

PDB Entry: 4mon, 2.3 Å

PDB Description: orthorhombic monellin

SCOP Domain Sequences for d4mon.3:

Sequence; same for both SEQRES and ATOM records:

>g4mon.3 d.17.1.1 (B:,A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq
lyvyasdklfradisedyktrgrkllrfngpvppp

Timeline for d4mon.3:

• d4mon.3 first appeared (with stable ids) in SCOP 1.55
  
• d4mon.3 appears in SCOP 1.65
  
• d4mon.3 appears in SCOP 1.69
  
• d4mon.3 appears in the current release, SCOPe 2.08