Lineage for d4mon.3 (4mon B:,A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 30955Superfamily d.17.1: Cystatin/monellin [54403] (2 families) (S)
  5. 30956Family d.17.1.1: Monellin [54404] (1 protein)
  6. 30957Protein Monellin, B & A chains together [54405] (1 species)
  7. 30958Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (5 PDB entries)
  8. 30961Domain d4mon.3: 4mon B:,A: [37990]

Details for d4mon.3

PDB Entry: 4mon (more details), 2.3 Å

PDB Description: orthorhombic monellin

SCOP Domain Sequences for d4mon.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g4mon.3 d.17.1.1 (B:,A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq
lyvyasdklfradisedyktrgrkllrfngpvppp

SCOP Domain Coordinates for d4mon.3:

Click to download the PDB-style file with coordinates for d4mon.3.
(The format of our PDB-style files is described here.)

Timeline for d4mon.3: