![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
![]() | Family d.17.1.1: Monellin [54404] (2 proteins) |
![]() | Protein Monellin, B & A chains together [54405] (1 species) |
![]() | Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries) |
![]() | Domain d4mon.3: 4mon B:,A: [37990] |
PDB Entry: 4mon (more details), 2.3 Å
SCOPe Domain Sequences for d4mon.3:
Sequence; same for both SEQRES and ATOM records: (download)
>g4mon.3 d.17.1.1 (B:,A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]} geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq lyvyasdklfradisedyktrgrkllrfngpvppp
Timeline for d4mon.3:
![]() Domains from other chains: (mouse over for more information) d4mon.4, d4mon.4, d4mon.4, d4mon.4 |