![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins) insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243 |
![]() | Protein automated matches [378998] (3 species) not a true protein |
![]() | Species Bacillus sp. [TaxId:1409] [379550] (4 PDB entries) |
![]() | Domain d6p01b1: 6p01 B:2-125 [379611] Other proteins in same PDB: d6p01a2, d6p01b2 automated match to d1knya2 protein/DNA complex; complexed with cl, gol, mg; mutant |
PDB Entry: 6p01 (more details), 1.89 Å
SCOPe Domain Sequences for d6p01b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p01b1 d.218.1.1 (B:2-125) automated matches {Bacillus sp. [TaxId: 1409]} ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdidmmcvmstee aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq taks
Timeline for d6p01b1: