Lineage for d6h05a_ (6h05 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874761Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 2874762Protein automated matches [190703] (7 species)
    not a true protein
  7. 2874804Species Human (Homo sapiens) [TaxId:9606] [351317] (2 PDB entries)
  8. 2874805Domain d6h05a_: 6h05 A: [379187]
    automated match to d1b5sa_

Details for d6h05a_

PDB Entry: 6h05 (more details), 2.9 Å

PDB Description: cryo-electron microscopic structure of the dihydrolipoamide succinyltransferase (e2) component of the human alpha-ketoglutarate (2-oxoglutarate) dehydrogenase complex [residues 218-453]
PDB Compounds: (A:) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial

SCOPe Domain Sequences for d6h05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h05a_ c.43.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glrsehrekmnrmrqriaqrlkeaqntcamlttfneidmsniqemrarhkeaflkkhnlk
lgfmsafvkasafalqeqpvvnaviddttkevvyrdyidisvavatprglvvpvirnvea
mnfadiertitelgekarknelaiedmdggtftisnggvfgslfgtpiinppqsailgmh
gifdrpvaiggkvevrpmmyvaltydhrlidgreavtflrkikaavedprvllldl

SCOPe Domain Coordinates for d6h05a_:

Click to download the PDB-style file with coordinates for d6h05a_.
(The format of our PDB-style files is described here.)

Timeline for d6h05a_: