Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) |
Family c.43.1.0: automated matches [191456] (1 protein) not a true family |
Protein automated matches [190703] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [351317] (2 PDB entries) |
Domain d6h05a_: 6h05 A: [379187] automated match to d1b5sa_ |
PDB Entry: 6h05 (more details), 2.9 Å
SCOPe Domain Sequences for d6h05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h05a_ c.43.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} glrsehrekmnrmrqriaqrlkeaqntcamlttfneidmsniqemrarhkeaflkkhnlk lgfmsafvkasafalqeqpvvnaviddttkevvyrdyidisvavatprglvvpvirnvea mnfadiertitelgekarknelaiedmdggtftisnggvfgslfgtpiinppqsailgmh gifdrpvaiggkvevrpmmyvaltydhrlidgreavtflrkikaavedprvllldl
Timeline for d6h05a_: