PDB entry 6h05

View 6h05 on RCSB PDB site
Description: Cryo-electron microscopic structure of the dihydrolipoamide succinyltransferase (E2) component of the human alpha-ketoglutarate (2-oxoglutarate) dehydrogenase complex [residues 218-453]
Class: transferase
Keywords: alpha-ketoglutarate dehydrogenase complex; 2-oxoglutarate dehydrogenase complex; dihydrolipoamide succinyltransferase; E2 component, TRANSFERASE
Deposited on 2018-07-06, released 2020-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: EM
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DLST, DLTS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h05a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h05A (A:)
    maswshpqfekgggsgggsggsawshpqfeklevlfqgpgddlvtvktpafaesvtegdv
    rwekavgdtvaedevvceietdktsvqvpspangvieallvpdggkveggtplftlrktg
    aapakakpaeapaaaapkaeptaaavpppaapiptqmppvpspsqppsgkpvsavkptva
    pplaepgagkglrsehrekmnrmrqriaqrlkeaqntcamlttfneidmsniqemrarhk
    eaflkkhnlklgfmsafvkasafalqeqpvvnaviddttkevvyrdyidisvavatprgl
    vvpvirnveamnfadiertitelgekarknelaiedmdggtftisnggvfgslfgtpiin
    ppqsailgmhgifdrpvaiggkvevrpmmyvaltydhrlidgreavtflrkikaavedpr
    vllldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h05A (A:)
    glrsehrekmnrmrqriaqrlkeaqntcamlttfneidmsniqemrarhkeaflkkhnlk
    lgfmsafvkasafalqeqpvvnaviddttkevvyrdyidisvavatprglvvpvirnvea
    mnfadiertitelgekarknelaiedmdggtftisnggvfgslfgtpiinppqsailgmh
    gifdrpvaiggkvevrpmmyvaltydhrlidgreavtflrkikaavedprvllldl