Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
Protein automated matches [190985] (6 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [378991] (1 PDB entry) |
Domain d6nmob_: 6nmo B: [379031] Other proteins in same PDB: d6nmoc2 automated match to d3ikfa_ complexed with dms, edo, mli, qms, zn |
PDB Entry: 6nmo (more details), 1.45 Å
SCOPe Domain Sequences for d6nmob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmob_ d.79.5.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]} mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa dldlpldrvnvkaktneklgylgrgegieaqaaalvvre
Timeline for d6nmob_: