Lineage for d6nmob_ (6nmo B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566989Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2566990Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2567088Protein automated matches [190985] (6 species)
    not a true protein
  7. 2567109Species Burkholderia pseudomallei [TaxId:320372] [378991] (1 PDB entry)
  8. 2567111Domain d6nmob_: 6nmo B: [379031]
    Other proteins in same PDB: d6nmoc2
    automated match to d3ikfa_
    complexed with dms, edo, mli, qms, zn

Details for d6nmob_

PDB Entry: 6nmo (more details), 1.45 Å

PDB Description: crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf) burkholderia pseudomallei in complex with ligand sr-4
PDB Compounds: (B:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d6nmob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmob_ d.79.5.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvre

SCOPe Domain Coordinates for d6nmob_:

Click to download the PDB-style file with coordinates for d6nmob_.
(The format of our PDB-style files is described here.)

Timeline for d6nmob_: