SCOPe 2.07: Domain d6nmla1: 6nml A:1-125

Lineage for d6nmla1 (6nml A:1-125)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
   insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243

6. Protein automated matches [378998] (3 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [378999] (4 PDB entries)

8. Domain d6nmla1: 6nml A:1-125 [379010]
   Other proteins in same PDB: d6nmla2, d6nmlb2
   automated match to d1knya2
   protein/DNA complex; complexed with apc, mg, nmy; mutant

Details for d6nmla1

PDB Entry: 6nml, 2 Å

PDB Description: ternary structure of the t130k mutant of ant-4'' with neomycin and ampcpp

PDB Compounds: (A:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6nmla1:

Sequence; same for both SEQRES and ATOM records:

>d6nmla1 d.218.1.1 (A:1-125) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
qtaks

Timeline for d6nmla1:

• d6nmla1 is new in SCOPe 2.07-stable
  
• d6nmla1 appears in the current release, SCOPe 2.08