Lineage for d6nmlb1 (6nml B:2-125)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2612758Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
    insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243
  6. 2612765Protein automated matches [378998] (3 species)
    not a true protein
  7. 2612775Species Geobacillus stearothermophilus [TaxId:1422] [378999] (4 PDB entries)
  8. 2612781Domain d6nmlb1: 6nml B:2-125 [379013]
    Other proteins in same PDB: d6nmla2, d6nmlb2
    automated match to d1knya2
    protein/DNA complex; complexed with apc, mg, nmy; mutant

Details for d6nmlb1

PDB Entry: 6nml (more details), 2 Å

PDB Description: ternary structure of the t130k mutant of ant-4'' with neomycin and ampcpp
PDB Compounds: (B:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6nmlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmlb1 d.218.1.1 (B:2-125) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmstee
aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
taks

SCOPe Domain Coordinates for d6nmlb1:

Click to download the PDB-style file with coordinates for d6nmlb1.
(The format of our PDB-style files is described here.)

Timeline for d6nmlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6nmlb2