SCOPe 2.08: Domain d6kr4d1: 6kr4 D:1332-1647

Lineage for d6kr4d1 (6kr4 D:1332-1647)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries)

8. Domain d6kr4d1: 6kr4 D:1332-1647 [378981]
   Other proteins in same PDB: d6kr4a3, d6kr4b3, d6kr4c3, d6kr4d3
   automated match to d2fh7a1
   complexed with p6g, pg4, pge, po4

Details for d6kr4d1

PDB Entry: 6kr4, 2.85 Å

PDB Description: crystal structure of the liprin-alpha3_sam123/lar_d1d2 complex

PDB Compounds: (D:) Receptor-type tyrosine-protein phosphatase F

SCOPe Domain Sequences for d6kr4d1:

Sequence; same for both SEQRES and ATOM records:

>d6kr4d1 c.45.1.2 (D:1332-1647) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipitdladnierlkandglkfsqeyesidpgqqftwensnlevnkpknryanviaydhsr
viltsidgvpgsdyinanyidgyrkqnayiatqgplpetmgdfwrmvweqrtatvvmmtr
leeksrvkcdqywpargtetcgliqvtlldtvelatytvrtfalhksgssekrelrqfqf
mawpdhgvpeyptpilaflrrvkacnpldagpmvvhcsagvgrtgcfividamlermkhe
ktvdiyghvtcmrsqrnymvqtedqyvfihealleaatcghtevparnlyahiqklgqvp
pgesvtamelefklla

Timeline for d6kr4d1:

• d6kr4d1 first appeared in SCOPe 2.07