Lineage for d6kr4d2 (6kr4 D:1656-1905)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875255Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2875600Protein automated matches [190252] (5 species)
    not a true protein
  7. 2875603Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries)
  8. 2875685Domain d6kr4d2: 6kr4 D:1656-1905 [378982]
    Other proteins in same PDB: d6kr4a3, d6kr4b3, d6kr4c3, d6kr4d3
    automated match to d2fh7a2
    complexed with p6g, pg4, pge, po4

Details for d6kr4d2

PDB Entry: 6kr4 (more details), 2.85 Å

PDB Description: crystal structure of the liprin-alpha3_sam123/lar_d1d2 complex
PDB Compounds: (D:) Receptor-type tyrosine-protein phosphatase F

SCOPe Domain Sequences for d6kr4d2:

Sequence, based on SEQRES records: (download)

>d6kr4d2 c.45.1.2 (D:1656-1905) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fisanlpcnkfknrlvnimpyeltrvclqpirgvegsdyinasfldgyrqqkayiatqgp
laestedfwrmlwehnstiivmltklremgrekchqywpaersaryqyfvvdpmaeynmp
qyilrefkvtdardgqsrtirqfqftdwpeqgvpktgegfidfigqvhktkeqfgqdgpi
tvhcsagvgrtgvfitlsivlermryegvvdmfqtvktlrtqrpamvqtedqyqlcyraa
leylgsfdhy

Sequence, based on observed residues (ATOM records): (download)

>d6kr4d2 c.45.1.2 (D:1656-1905) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fisanlpcnkfknrlvnimpyeltrvclqpivegsdyinasfldgyrqqkayiatqgpla
estedfwrmlwehnstiivmltklremgrekchqywpaersaryqyfvvdpmaeynmpqy
ilrefkvtdardgqsrtirqfqftdwpeqgvpktgegfidfigqvhktkeqfgqdgpitv
hcsagvgrtgvfitlsivlermryegvvdmfqtvktlrtqrpamvqtedqyqlcyraale
ylgsfdhy

SCOPe Domain Coordinates for d6kr4d2:

Click to download the PDB-style file with coordinates for d6kr4d2.
(The format of our PDB-style files is described here.)

Timeline for d6kr4d2: