SCOPe 2.01: Domain d1pxba2: 1pxb A:174-275

Lineage for d1pxba2 (1pxb A:174-275)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.2: PHBH-like [54378] (4 proteins)

6. Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [54381] (18 PDB entries)

8. Domain d1pxba2: 1pxb A:174-275 [37898]
   Other proteins in same PDB: d1pxba1
   complexed with fad, phb; mutant

Details for d1pxba2

PDB Entry: 1pxb, 2.3 Å

PDB Description: crystal structures of mutant pseudomonas aeruginosa p-hydroxybenzoate hydroxylase: the tyr201phe, tyr385phe, and asn300asp variants

PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOPe Domain Sequences for d1pxba2:

Sequence; same for both SEQRES and ATOM records:

>d1pxba2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa [TaxId: 287]}
lkvfervypfgwlglladtppvshelifanhprgfalcsqrsatrsryyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep

Timeline for d1pxba2:

• d1pxba2 first appeared (with stable ids) in SCOP 1.55, called d1pxb_2
  
• d1pxba2 appears in SCOP 1.75
  
• d1pxba2 appears in SCOPe 2.02
  
• d1pxba2 appears in the current release, SCOPe 2.08