Lineage for d1pxb_2 (1pxb 174-275)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) 
Family d.16.1.2: PHBH-like [54378] (2 proteins) Protein p-Hydroxybenzoate hydroxylase, PHBH [54379] (2 species) 
Species Pseudomonas aeruginosa [TaxId:287] [54381] (14 PDB entries) 
Domain d1pxb_2: 1pxb 174-275 [37898]
Other proteins in same PDB: d1pxb_1
Details for d1pxb_2
PDB Entry: 1pxb (more details), 2.3 Å
PDB Description: crystal structures of mutant pseudomonas aeruginosa p-hydroxybenzoate hydroxylase: the tyr201phe, tyr385phe, and asn300asp variants
SCOP Domain Sequences for d1pxb_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pxb_2 d.16.1.2 (174-275) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa}
lkvfervypfgwlglladtppvshelifanhprgfalcsqrsatrsryyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep
SCOP Domain Coordinates for d1pxb_2:
Click to download the PDB-style file with coordinates for d1pxb_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pxb_2:
- d1pxb_2 appears in SCOP 1.57
- d1pxb_2 appears in the current release, SCOPe 2.08, called d1pxba2
View in 3D
