Lineage for d6kloh2 (6klo H:210-413)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000572Protein automated matches [190133] (8 species)
    not a true protein
  7. 3000636Species Clostridium perfringens [TaxId:1502] [234554] (8 PDB entries)
  8. 3000650Domain d6kloh2: 6klo H:210-413 [378957]
    automated match to d1giqa2
    complexed with ca

Details for d6kloh2

PDB Entry: 6klo (more details), 2.8 Å

PDB Description: complex structure of iota toxin enzymatic component (ia) and binding component (ib) pore with short stem
PDB Compounds: (H:) Iota toxin component Ia

SCOPe Domain Sequences for d6kloh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kloh2 d.166.1.1 (H:210-413) automated matches {Clostridium perfringens [TaxId: 1502]}
sldfkddvskgdlwgkenysdwsnkltpneladvndymrggytainnylisngplnnpnp
eldskvnnienalkltpipsnlivyrrsgpqefgltltspeydfnkienidafkekwegk
vitypnfistsigsvnmsafakrkiilrinipkdspgaylsaipgyageyevllnhgskf
kinkvdsykdgtvtklildatlin

SCOPe Domain Coordinates for d6kloh2:

Click to download the PDB-style file with coordinates for d6kloh2.
(The format of our PDB-style files is described here.)

Timeline for d6kloh2:

3000650
d6kloh2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6kloh1