Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) |
Family d.16.1.2: PHBH-like [54378] (2 proteins) |
Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species) |
Species Pseudomonas aeruginosa [TaxId:287] [54381] (14 PDB entries) |
Domain d1iux_2: 1iux 174-275 [37889] Other proteins in same PDB: d1iux_1 |
PDB Entry: 1iux (more details), 2 Å
SCOP Domain Sequences for d1iux_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iux_2 d.16.1.2 (174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa} lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep
Timeline for d1iux_2: