Lineage for d1iux_2 (1iux 174-275)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) 
Family d.16.1.2: PHBH-like [54378] (2 proteins) Protein p-Hydroxybenzoate hydroxylase, PHBH [54379] (2 species) 
Species Pseudomonas aeruginosa [TaxId:287] [54381] (14 PDB entries) 
Domain d1iux_2: 1iux 174-275 [37889]
Other proteins in same PDB: d1iux_1
Details for d1iux_2
PDB Entry: 1iux (more details), 2 Å
PDB Description: p-hydroxybenzoate hydroxylase complexed with 4-4-hydroxybenzoate at ph 9.4
SCOP Domain Sequences for d1iux_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iux_2 d.16.1.2 (174-275) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep
SCOP Domain Coordinates for d1iux_2:
Click to download the PDB-style file with coordinates for d1iux_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iux_2:
- d1iux_2 appears in SCOP 1.57
- d1iux_2 appears in the current release, SCOPe 2.08, called d1iuxa2
View in 3D
