Lineage for d1iux_1 (1iux 1-173,276-394)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67095Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins)
  6. 67126Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)
  7. 67127Species Pseudomonas aeruginosa [TaxId:287] [51919] (14 PDB entries)
  8. 67132Domain d1iux_1: 1iux 1-173,276-394 [30358]
    Other proteins in same PDB: d1iux_2

Details for d1iux_1

PDB Entry: 1iux (more details), 2 Å

PDB Description: p-hydroxybenzoate hydroxylase complexed with 4-4-hydroxybenzoate at ph 9.4

SCOP Domain Sequences for d1iux_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iux_1 c.3.1.2 (1-173,276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie

SCOP Domain Coordinates for d1iux_1:

Click to download the PDB-style file with coordinates for d1iux_1.
(The format of our PDB-style files is described here.)

Timeline for d1iux_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iux_2