Lineage for d6isnb_ (6isn B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2891019Protein automated matches [190196] (7 species)
    not a true protein
  7. 2891039Species Human (Homo sapiens) [TaxId:9606] [186938] (20 PDB entries)
  8. 2891058Domain d6isnb_: 6isn B: [377979]
    automated match to d1yjxe_
    complexed with aw6, cl, mes

Details for d6isnb_

PDB Entry: 6isn (more details), 1.98 Å

PDB Description: phosphoglycerate mutase 1 complexed with a small molecule inhibitor
PDB Compounds: (B:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d6isnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6isnb_ c.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd

SCOPe Domain Coordinates for d6isnb_:

Click to download the PDB-style file with coordinates for d6isnb_.
(The format of our PDB-style files is described here.)

Timeline for d6isnb_: