SCOPe 2.08: Domain d5vpjc_: 5vpj C:

Lineage for d5vpjc_ (5vpj C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Actinomadura verrucosospora [TaxId:46165] [377917] (1 PDB entry)

8. Domain d5vpjc_: 5vpj C: [377939]
   automated match to d2xflg_
   complexed with cl, pg4

Details for d5vpjc_

PDB Entry: 5vpj, 2.35 Å

PDB Description: the crystal structure of a thioesteras from actinomadura verrucosospora.

PDB Compounds: (C:) thioesterase

SCOPe Domain Sequences for d5vpjc_:

Sequence, based on SEQRES records:

>d5vpjc_ d.38.1.0 (C:) automated matches {Actinomadura verrucosospora [TaxId: 46165]}
ayfeyrhlvtfadtnlvgnvyftnylswqgacrerflaekapktvarmhddlalvtsscs
ceffselyaldtvsvrmslvgidfhqitmgfeyyrvtdgparlvargeqtvactlraedg
ltpvevpdelrtaldayapd

Sequence, based on observed residues (ATOM records):

>d5vpjc_ d.38.1.0 (C:) automated matches {Actinomadura verrucosospora [TaxId: 46165]}
ayfeyrhlvtfadtnlvgnvyftnylswqgacrerflaekapktvarmhddlalvtsscs
ceffselyaldtvsvrmslvgidfhqitmgfeyyrvdgparlvargeqtvactlraedgl
tpvevpdelrtaldayapd

Timeline for d5vpjc_:

• d5vpjc_ first appeared in SCOPe 2.07