Lineage for d5vpjj_ (5vpj J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944314Species Actinomadura verrucosospora [TaxId:46165] [377917] (1 PDB entry)
  8. 2944324Domain d5vpjj_: 5vpj J: [377928]
    automated match to d2xflg_
    complexed with cl, pg4

Details for d5vpjj_

PDB Entry: 5vpj (more details), 2.35 Å

PDB Description: the crystal structure of a thioesteras from actinomadura verrucosospora.
PDB Compounds: (J:) thioesterase

SCOPe Domain Sequences for d5vpjj_:

Sequence, based on SEQRES records: (download)

>d5vpjj_ d.38.1.0 (J:) automated matches {Actinomadura verrucosospora [TaxId: 46165]}
yfeyrhlvtfadtnlvgnvyftnylswqgacrerflaekapktvarmhddlalvtsscsc
effselyaldtvsvrmslvgidfhqitmgfeyyrvtdgparlvargeqtvactlraedgl
tpvevpdelrtaldayap

Sequence, based on observed residues (ATOM records): (download)

>d5vpjj_ d.38.1.0 (J:) automated matches {Actinomadura verrucosospora [TaxId: 46165]}
yfeyrhlvtfadtnlvgnvyftnylswqgacrerflaekapktvarmhdlalvtsscsce
ffselyaldtvsvrmslvgidfhqitmgfeyyrvtdgparlvargeqtvactlrltpvev
pdelrtaldayap

SCOPe Domain Coordinates for d5vpjj_:

Click to download the PDB-style file with coordinates for d5vpjj_.
(The format of our PDB-style files is described here.)

Timeline for d5vpjj_: