SCOPe 2.08: Domain d6u5sd_: 6u5s D:

Lineage for d6u5sd_ (6u5s D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (8 PDB entries)

8. Domain d6u5sd_: 6u5s D: [377887]
   automated match to d3h5va_
   complexed with bma, nag

Details for d6u5sd_

PDB Entry: 6u5s, 3.07 Å

PDB Description: ntd of glua2 in complex with cnih3 - with antagonist zk200775 - in pseudo-symmetric global conformation

PDB Compounds: (D:) Glutamate receptor 2

SCOPe Domain Sequences for d6u5sd_:

Sequence; same for both SEQRES and ATOM records:

>d6u5sd_ c.93.1.1 (D:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
kigywsevdkmvvtlt

Timeline for d6u5sd_:

• d6u5sd_ first appeared in SCOPe 2.07