Lineage for d6u5sb_ (6u5s B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913020Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species)
  7. 2913021Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (8 PDB entries)
  8. 2913033Domain d6u5sb_: 6u5s B: [377874]
    automated match to d3h5va_
    complexed with bma, nag

Details for d6u5sb_

PDB Entry: 6u5s (more details), 3.07 Å

PDB Description: ntd of glua2 in complex with cnih3 - with antagonist zk200775 - in pseudo-symmetric global conformation
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d6u5sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u5sb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
kigywsevdkmvvtlt

SCOPe Domain Coordinates for d6u5sb_:

Click to download the PDB-style file with coordinates for d6u5sb_.
(The format of our PDB-style files is described here.)

Timeline for d6u5sb_: