Lineage for d3h5va_ (3h5v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913020Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species)
  7. 2913021Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (8 PDB entries)
  8. 2913026Domain d3h5va_: 3h5v A: [264822]

Details for d3h5va_

PDB Entry: 3h5v (more details), 2.33 Å

PDB Description: crystal structure of the glur2-atd
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d3h5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h5va_ c.93.1.1 (A:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsr
gvyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyy
qwdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkk
errvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqiv
dyddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisr
rgnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngp
rkigywsevdkmvvtl

SCOPe Domain Coordinates for d3h5va_:

Click to download the PDB-style file with coordinates for d3h5va_.
(The format of our PDB-style files is described here.)

Timeline for d3h5va_: