Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (28 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [377859] (1 PDB entry) |
Domain d6u01a_: 6u01 A: [377864] automated match to d3lera_ complexed with act, edo, gol, mg, peg, pg4, pge; mutant |
PDB Entry: 6u01 (more details), 1.87 Å
SCOPe Domain Sequences for d6u01a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u01a_ c.1.10.1 (A:) automated matches {Campylobacter jejuni [TaxId: 197]} kniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtc ieiavetckgtkvkvlagagsdatheavglakfakehgadgilsvapyynkptqqglyeh ykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahe prmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyn inkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf
Timeline for d6u01a_: