Lineage for d6u01a_ (6u01 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835004Species Campylobacter jejuni [TaxId:197] [377859] (1 PDB entry)
  8. 2835005Domain d6u01a_: 6u01 A: [377864]
    automated match to d3lera_
    complexed with act, edo, gol, mg, peg, pg4, pge; mutant

Details for d6u01a_

PDB Entry: 6u01 (more details), 1.87 Å

PDB Description: dihydrodipicolinate synthase (dhdps) from c.jejuni, n84d mutant with pyruvate bound in the active site
PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d6u01a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u01a_ c.1.10.1 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
kniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtc
ieiavetckgtkvkvlagagsdatheavglakfakehgadgilsvapyynkptqqglyeh
ykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahe
prmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyn
inkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d6u01a_:

Click to download the PDB-style file with coordinates for d6u01a_.
(The format of our PDB-style files is described here.)

Timeline for d6u01a_: