Lineage for d3lera_ (3ler A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834536Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2834546Species Campylobacter jejuni [TaxId:192222] [189204] (3 PDB entries)
  8. 2834547Domain d3lera_: 3ler A: [180235]
    automated match to d1o5ka_
    complexed with acy, edo, fmt, mg, peg

    has additional insertions and/or extensions that are not grouped together

Details for d3lera_

PDB Entry: 3ler (more details), 1.84 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from campylobacter jejuni subsp. jejuni nctc 11168
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3lera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lera_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Campylobacter jejuni [TaxId: 192222]}
mdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehr
tcieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqgly
ehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdlla
heprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindel
yninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d3lera_:

Click to download the PDB-style file with coordinates for d3lera_.
(The format of our PDB-style files is described here.)

Timeline for d3lera_: