Class b: All beta proteins [48724] (180 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein automated matches [193245] (21 species) not a true protein |
Species Influenza a virus (a/hunan/02650/2016(h7n9) [TaxId:1332244] [377789] (1 PDB entry) |
Domain d6pzfa_: 6pzf A: [377790] Other proteins in same PDB: d6pzfe1, d6pzfe2, d6pzff_, d6pzfh_, d6pzfl1, d6pzfl2 automated match to d1f8ea_ complexed with bma, ca, man, nag, po4 |
PDB Entry: 6pzf (more details), 2.8 Å
SCOPe Domain Sequences for d6pzfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pzfa_ b.68.1.1 (A:) automated matches {Influenza a virus (a/hunan/02650/2016(h7n9) [TaxId: 1332244]} rnfnnltkglctinswhiygkdnavrigessdvlvtrepyvscdpdecrfyalsqgttir gkhsngtihdrsqyraliswplsspptvhnsrvecigwsstschdgksrmsicisgpnnn asavvwynrrpvaeintwarnilrtqesecvchngvcpvvftdgpatgpadtriyyfkeg kilkwesltgtakhieecscygertgitctcrdnwqgsnrpvvqidpvamthtsqyicsp vltdsprpndpnigkcndpypgnnnngvkgfsyldgantwlgrtistasrsgyemlkvpn altddrskpiqgqtivlnadwsgysgsfmdywaegdcyracfyvelirgrpkedkvwwts nsivsmcssteflgqwnwpdgakieyfl
Timeline for d6pzfa_: