SCOPe 2.08: Domain d6kykd1: 6kyk D:1-167

Lineage for d6kykd1 (6kyk D:1-167)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6kykd1: 6kyk D:1-167 [377711]
   Other proteins in same PDB: d6kykc2, d6kykd2, d6kyke2, d6kykf2
   automated match to d4hdob_
   complexed with gnp, mg; mutant

Details for d6kykd1

PDB Entry: 6kyk, 2.82 Å

PDB Description: crystal structure of shank3 ntd-ank mutant in complex with rap1

PDB Compounds: (D:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d6kykd1:

Sequence; same for both SEQRES and ATOM records:

>d6kykd1 c.37.1.8 (D:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

Timeline for d6kykd1:

• d6kykd1 first appeared in SCOPe 2.07