Lineage for d6l8qe1 (6l8q E:38-503)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419317Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2419478Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2419479Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2419762Protein automated matches [226889] (4 species)
    not a true protein
  7. 2419770Species Myotis davidii [TaxId:225400] [377685] (1 PDB entry)
  8. 2419773Domain d6l8qe1: 6l8q E:38-503 [377686]
    Other proteins in same PDB: d6l8qa2, d6l8qc2, d6l8qe2, d6l8qg2
    automated match to d1orva1
    complexed with bma, nag

Details for d6l8qe1

PDB Entry: 6l8q (more details), 3.1 Å

PDB Description: complex structure of bat cd26 and mers-rbd
PDB Compounds: (E:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d6l8qe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l8qe1 b.70.3.1 (E:38-503) automated matches {Myotis davidii [TaxId: 225400]}
rrtytladylkstirmrnynlrwisdheylykqennvllfnadhgnsstflenstfdqfg
hsisdysvspdrqfvlfeynyvkkwrhsytasydiydlnkrqlitaeripndtqlirwsp
eghklayvwnndvyvkndpyspsqrvthdgredaisngitdwvyeeeifsthsalwwspn
gtflayakfndtdvprieysvyldeslqypktihipypkagaknptvklyvvntdnltdl
epaqivapasvltgdhylcdvtwatkerislqwlrriqnysiidicdynestpkwnclvs
rqhietsatgwvgrfkpaephftsdgnsfykimsnsegykhiclfqidkpdctfitkgaw
evigiealtndylyfisneykgmpggrnlykiqlnnyanvtclsceldpercqyysasfs
kgakyyqlrcsgpqipryslhsssndkelrllenntalyetlqniq

SCOPe Domain Coordinates for d6l8qe1:

Click to download the PDB-style file with coordinates for d6l8qe1.
(The format of our PDB-style files is described here.)

Timeline for d6l8qe1: