SCOPe 2.07: Domain d6l8qc1: 6l8q C:38-503

Lineage for d6l8qc1 (6l8q C:38-503)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein automated matches [226889] (4 species)
   not a true protein

7. Species Myotis davidii [TaxId:225400] [377685] (1 PDB entry)

8. Domain d6l8qc1: 6l8q C:38-503 [377696]
   Other proteins in same PDB: d6l8qa2, d6l8qc2, d6l8qe2, d6l8qg2
   automated match to d1orva1
   complexed with bma, nag

Details for d6l8qc1

PDB Entry: 6l8q, 3.1 Å

PDB Description: complex structure of bat cd26 and mers-rbd

PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d6l8qc1:

Sequence; same for both SEQRES and ATOM records:

>d6l8qc1 b.70.3.1 (C:38-503) automated matches {Myotis davidii [TaxId: 225400]}
rrtytladylkstirmrnynlrwisdheylykqennvllfnadhgnsstflenstfdqfg
hsisdysvspdrqfvlfeynyvkkwrhsytasydiydlnkrqlitaeripndtqlirwsp
eghklayvwnndvyvkndpyspsqrvthdgredaisngitdwvyeeeifsthsalwwspn
gtflayakfndtdvprieysvyldeslqypktihipypkagaknptvklyvvntdnltdl
epaqivapasvltgdhylcdvtwatkerislqwlrriqnysiidicdynestpkwnclvs
rqhietsatgwvgrfkpaephftsdgnsfykimsnsegykhiclfqidkpdctfitkgaw
evigiealtndylyfisneykgmpggrnlykiqlnnyanvtclsceldpercqyysasfs
kgakyyqlrcsgpqipryslhsssndkelrllenntalyetlqniq

Timeline for d6l8qc1:

• d6l8qc1 is new in SCOPe 2.07-stable
  
• d6l8qc1 appears in the current release, SCOPe 2.08