Class b: All beta proteins [48724] (178 folds) |
Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) automatically mapped to Pfam PF00930 |
Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
Protein automated matches [226889] (4 species) not a true protein |
Species Myotis davidii [TaxId:225400] [377685] (1 PDB entry) |
Domain d6l8qc1: 6l8q C:38-503 [377696] Other proteins in same PDB: d6l8qa2, d6l8qc2, d6l8qe2, d6l8qg2 automated match to d1orva1 complexed with bma, nag |
PDB Entry: 6l8q (more details), 3.1 Å
SCOPe Domain Sequences for d6l8qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l8qc1 b.70.3.1 (C:38-503) automated matches {Myotis davidii [TaxId: 225400]} rrtytladylkstirmrnynlrwisdheylykqennvllfnadhgnsstflenstfdqfg hsisdysvspdrqfvlfeynyvkkwrhsytasydiydlnkrqlitaeripndtqlirwsp eghklayvwnndvyvkndpyspsqrvthdgredaisngitdwvyeeeifsthsalwwspn gtflayakfndtdvprieysvyldeslqypktihipypkagaknptvklyvvntdnltdl epaqivapasvltgdhylcdvtwatkerislqwlrriqnysiidicdynestpkwnclvs rqhietsatgwvgrfkpaephftsdgnsfykimsnsegykhiclfqidkpdctfitkgaw evigiealtndylyfisneykgmpggrnlykiqlnnyanvtclsceldpercqyysasfs kgakyyqlrcsgpqipryslhsssndkelrllenntalyetlqniq
Timeline for d6l8qc1: