Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225164] (4 PDB entries) |
Domain d6j2ma_: 6j2m A: [377684] automated match to d2ki3a_ complexed with cl, fk5 |
PDB Entry: 6j2m (more details), 1.13 Å
SCOPe Domain Sequences for d6j2ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j2ma_ d.26.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ypngliveelsmgkpngkradpgktvsvryigklqkngkifdsnigkspfkfrlgigsvi kgwdvgvngmrvgdkrkltippsmgygvkgaggqippnswltfdvelinvq
Timeline for d6j2ma_: