Lineage for d6j2ma_ (6j2m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941842Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225164] (4 PDB entries)
  8. 2941843Domain d6j2ma_: 6j2m A: [377684]
    automated match to d2ki3a_
    complexed with cl, fk5

Details for d6j2ma_

PDB Entry: 6j2m (more details), 1.13 Å

PDB Description: crystal structure of atfkbp53 c-terminal domain
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP53

SCOPe Domain Sequences for d6j2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j2ma_ d.26.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ypngliveelsmgkpngkradpgktvsvryigklqkngkifdsnigkspfkfrlgigsvi
kgwdvgvngmrvgdkrkltippsmgygvkgaggqippnswltfdvelinvq

SCOPe Domain Coordinates for d6j2ma_:

Click to download the PDB-style file with coordinates for d6j2ma_.
(The format of our PDB-style files is described here.)

Timeline for d6j2ma_: