![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
![]() | Protein automated matches [191162] (29 species) not a true protein |
![]() | Species Plasmodium vivax [TaxId:5855] [189364] (5 PDB entries) |
![]() | Domain d2ki3a_: 2ki3 A: [242519] automated match to d3ni6a_ |
PDB Entry: 2ki3 (more details)
SCOPe Domain Sequences for d2ki3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ki3a_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]} meqetleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrer nvpfkfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeie lisfre
Timeline for d2ki3a_: