![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins) |
![]() | Protein Uridine-cytidine kinase 2 [102360] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102361] (10 PDB entries) |
![]() | Domain d6n55a_: 6n55 A: [377451] automated match to d1uejb_ complexed with gol, po4, uz0 |
PDB Entry: 6n55 (more details), 3.09 Å
SCOPe Domain Sequences for d6n55a_:
Sequence, based on SEQRES records: (download)
>d6n55a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl ptkkyadviiprgadnlvainlivqhiqdilngg
>d6n55a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvlqfnfdhpdaf dnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilafysqevrdlf qmklfvdtdadtrlsrrvlrdiserdleqilsqyitfvkpafeefclptkkyadviiprg adnlvainlivqhiqdilngg
Timeline for d6n55a_: