PDB entry 6n55

View 6n55 on RCSB PDB site
Description: Crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidouridine
Class: cytosolic protein
Keywords: Uridine-cytidine kinase 2, UCK2, Kinase, Complex, Azide, CYTOSOLIC PROTEIN
Deposited on 2018-11-21, released 2019-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n55a_
  • Chain 'B':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n55b_
  • Chain 'C':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n55c_
  • Chain 'D':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n55d_
  • Chain 'E':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n55e_
  • Chain 'F':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n55f_
  • Chain 'G':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n55g_
  • Chain 'H':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n55h_
  • Heterogens: PO4, GOL, UZ0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n55A (A:)
    gplgsmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkq
    vvilsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfv
    shsrkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdiserg
    rdleqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpsk
    rqtngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n55A (A:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvlqfnfdhpdaf
    dnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilafysqevrdlf
    qmklfvdtdadtrlsrrvlrdiserdleqilsqyitfvkpafeefclptkkyadviiprg
    adnlvainlivqhiqdilngg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n55B (B:)
    gplgsmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkq
    vvilsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfv
    shsrkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdiserg
    rdleqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpsk
    rqtngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n55B (B:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkaqfnf
    dhpdafdnelilktlkeitegktvqipvyvshsrkeetvtvypadvvlfegilafysqev
    rdlfqmklfvdtdadtrlsrrvlrdiserrdleqilsqyitfvkpafeefclptkkyadv
    iiprgadnlvainlivqhiqdilngg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n55C (C:)
    gplgsmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkq
    vvilsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfv
    shsrkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdiserg
    rdleqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpsk
    rqtngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n55C (C:)
    pfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalkg
    qfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegila
    fysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclp
    tkkyadviiprgadnlvainlivqhiqdilng
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6n55D (D:)
    gplgsmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkq
    vvilsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfv
    shsrkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdiserg
    rdleqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpsk
    rqtngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n55D (D:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdilng
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6n55E (E:)
    gplgsmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkq
    vvilsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfv
    shsrkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdiserg
    rdleqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpsk
    rqtngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n55E (E:)
    gepfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakal
    kgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegi
    lafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefc
    lptkkyadviiprgadnlvainlivqhiqdilng
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6n55F (F:)
    gplgsmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkq
    vvilsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfv
    shsrkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdiserg
    rdleqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpsk
    rqtngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n55F (F:)
    gepfligvsggtasgkssvcakivqllgqndyrqkqvvilsqdsfyrvltseqkakalkg
    qfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegila
    fysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclp
    tkkyadviiprgadnlvainlivqhiqdilng
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6n55G (G:)
    gplgsmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkq
    vvilsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfv
    shsrkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdiserg
    rdleqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpsk
    rqtngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n55G (G:)
    pfligvsggtasgkssvcakivqllgqnevdyrkqvvilsqdsfyrvlakalkgqfnfdh
    pdafdnelilktlkeitegktvqipvshsrkeetvtvypadvvlfegilafysqevrdlf
    qmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclptkkyadviip
    rgadnlvainlivqhiqdiln
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6n55H (H:)
    gplgsmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkq
    vvilsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfv
    shsrkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdiserg
    rdleqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpsk
    rqtngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n55H (H:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvleqkakalkgq
    fnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilaf
    ysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclpt
    kkyadviiprgadnlvainlivqhiqdilng