Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species) protein duplication: contains two Tudor domains in tandem |
Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
Domain d6my0b2: 6my0 B:1538-1602 [377371] Other proteins in same PDB: d6my0a1, d6my0a3, d6my0b1 automated match to d1ssfa2 mutant |
PDB Entry: 6my0 (more details), 2.2 Å
SCOPe Domain Sequences for d6my0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6my0b2 b.34.9.1 (B:1538-1602) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ipldtevtalspneyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr eqygl
Timeline for d6my0b2: