Lineage for d6i71b2 (6i71 B:120-365)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893124Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
    automatically mapped to Pfam PF00891
  6. 2893164Protein automated matches [226979] (4 species)
    not a true protein
  7. 2893184Species Fragaria ananassa [TaxId:3747] [377223] (5 PDB entries)
  8. 2893188Domain d6i71b2: 6i71 B:120-365 [377276]
    Other proteins in same PDB: d6i71a1, d6i71a3, d6i71b1, d6i71b3
    automated match to d1kyzc2
    complexed with edo, sah, so4

Details for d6i71b2

PDB Entry: 6i71 (more details), 1.4 Å

PDB Description: structure of fragaria ananassa o-methyltransferase in complex with s- adenosylhomocysteine
PDB Compounds: (B:) O-methyltransferase

SCOPe Domain Sequences for d6i71b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i71b2 c.66.1.12 (B:120-365) automated matches {Fragaria ananassa [TaxId: 3747]}
dgvsiaalclmnqdkvlveswyhlkdavldggipfnkaygmtafdyhgtdprfnkvfnkg
madhstitmkkiletykgfeglksivdvgggtgavvnmivskypsikginfdlphvieda
pqypgvqhvggdmfvsvpkgnaifmkwichdwsdehcikflkncyaalpddgkvilaeci
lpvapdtslatkgvvhmdvimlahnpggkerteqefealakgsgfqgirvccdafntyvi
eflkki

SCOPe Domain Coordinates for d6i71b2:

Click to download the PDB-style file with coordinates for d6i71b2.
(The format of our PDB-style files is described here.)

Timeline for d6i71b2: