SCOPe 2.08: Domain d6izob1: 6izo B:1-118

Lineage for d6izob1 (6izo B:1-118)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Caulobacter crescentus [TaxId:190650] [337115] (2 PDB entries)

8. Domain d6izob1: 6izo B:1-118 [377249]
   Other proteins in same PDB: d6izoa4, d6izob4
   automated match to d5wcea1
   complexed with edo, peg

Details for d6izob1

PDB Entry: 6izo, 1.94 Å

PDB Description: crystal structure of dna polymerase sliding clamp from caulobacter crescentus

PDB Compounds: (B:) Beta sliding clamp

SCOPe Domain Sequences for d6izob1:

Sequence, based on SEQRES records:

>d6izob1 d.131.1.0 (B:1-118) automated matches {Caulobacter crescentus [TaxId: 190650]}
mkltieraallkalghvqsvverrntipilsnillsaegdrlsfsatdldmeiidegfaq
idvpgqitapahtlyeivrklpdgadvslsfsgddprlviqagrsrfnlpvlpagdfp

Sequence, based on observed residues (ATOM records):

>d6izob1 d.131.1.0 (B:1-118) automated matches {Caulobacter crescentus [TaxId: 190650]}
mkltieraallkalghvqsvverrntipilsnillsaegdrlsfsatdldmeiidegfaq
idvpgqitapahtlyeivrklpdgadvslsfddprlviqagrsrfnlpvlpagdfp

Timeline for d6izob1:

• d6izob1 first appeared in SCOPe 2.07