Lineage for d5wcea1 (5wce A:1-118)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977305Species Caulobacter crescentus [TaxId:190650] [337115] (2 PDB entries)
  8. 2977306Domain d5wcea1: 5wce A:1-118 [337116]
    automated match to d4tr8b1

Details for d5wcea1

PDB Entry: 5wce (more details), 1.9 Å

PDB Description: caulobacter crescentus pol iii beta
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5wcea1:

Sequence, based on SEQRES records: (download)

>d5wcea1 d.131.1.0 (A:1-118) automated matches {Caulobacter crescentus [TaxId: 190650]}
mkltieraallkalghvqsvverrntipilsnillsaegdrlsfsatdldmeiidegfaq
idvpgqitapahtlyeivrklpdgadvslsfsgddprlviqagrsrfnlpvlpagdfp

Sequence, based on observed residues (ATOM records): (download)

>d5wcea1 d.131.1.0 (A:1-118) automated matches {Caulobacter crescentus [TaxId: 190650]}
mkltieraallkalghvqsvverrntipilsnillsaegdrlsfsatdldmeiidegfaq
idvpgqitapahtlyeivrklpdgadvslsfddprlviqagrsrfnlpvlpagdfp

SCOPe Domain Coordinates for d5wcea1:

Click to download the PDB-style file with coordinates for d5wcea1.
(The format of our PDB-style files is described here.)

Timeline for d5wcea1: