| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
| Protein automated matches [226907] (28 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:983919] [259535] (1 PDB entry) |
| Domain d4tr8b1: 4tr8 B:1-117 [259536] Other proteins in same PDB: d4tr8a4, d4tr8b4 automated match to d1vpka1 complexed with na |
PDB Entry: 4tr8 (more details), 1.8 Å
SCOPe Domain Sequences for d4tr8b1:
Sequence, based on SEQRES records: (download)
>d4tr8b1 d.131.1.0 (B:1-117) automated matches {Pseudomonas aeruginosa [TaxId: 983919]}
mhftiqreallkplqlvagvverrqtlpvlsnvllvvegqqlsltgtdlevelvgrvvle
daaepgeitvparklmdickslpndvlidirveeqkllvkagrsrftlstlpandfp
>d4tr8b1 d.131.1.0 (B:1-117) automated matches {Pseudomonas aeruginosa [TaxId: 983919]}
mhftiqreallkplqlvagvvetlpvlsnvllvvegqqlsltgtdlevelvgrvvledaa
epgeitvparklmdickslpndvlidirveeqkllvkagrsrftlstlpandfp
Timeline for d4tr8b1:
View in 3DDomains from other chains: (mouse over for more information) d4tr8a1, d4tr8a2, d4tr8a3, d4tr8a4 |