Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (6 proteins) |
Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species) |
Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries) |
Domain d1ffvd2: 1ffv D:2-81 [37701] Other proteins in same PDB: d1ffva1, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2 |
PDB Entry: 1ffv (more details), 2.25 Å
SCOP Domain Sequences for d1ffvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffvd2 d.15.4.2 (D:2-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava} akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks cthlavqcdgsevltvegla
Timeline for d1ffvd2: