SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ffvd2 (1ffv D:2-81)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2159971Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 protein domains)
  6. 2159998Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (3 species)
  7. 2159999Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries)
  8. 2160001Domain d1ffvd2: 1ffv D:2-81 [37701]
    Other proteins in same PDB: d1ffva1, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2
    complexed with fad, fes, pcd

Details for d1ffvd2

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
PDB Compounds: (D:) cuts, iron-sulfur protein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffvd2 d.15.4.2 (D:2-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks
cthlavqcdgsevltvegla

SCOPe Domain Coordinates for d1ffvd2:

Click to download the PDB-style file with coordinates for d1ffvd2.
(The format of our PDB-style files is described here.)

Timeline for d1ffvd2: