SCOP 1.55: Domain d1ffvd2: 1ffv D:2-81

Lineage for d1ffvd2 (1ffv D:2-81)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (6 proteins)

6. Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)

7. Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries)

8. Domain d1ffvd2: 1ffv D:2-81 [37701]
   Other proteins in same PDB: d1ffva1, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2

Details for d1ffvd2

PDB Entry: 1ffv, 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

SCOP Domain Sequences for d1ffvd2:

Sequence; same for both SEQRES and ATOM records:

>d1ffvd2 d.15.4.2 (D:2-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava}
akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks
cthlavqcdgsevltvegla

Timeline for d1ffvd2:

• d1ffvd2 appears in SCOP 1.57
  
• d1ffvd2 appears in the current release, SCOPe 2.08