Lineage for d6u7fa1 (6u7f A:66-287)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2429865Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2429866Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2429953Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2429954Protein automated matches [254706] (5 species)
    not a true protein
  7. 2429958Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2429991Domain d6u7fa1: 6u7f A:66-287 [376929]
    Other proteins in same PDB: d6u7fa2, d6u7fa3, d6u7fa4, d6u7fb2, d6u7fb3, d6u7fb4
    automated match to d4fyqa1
    complexed with nag, zn

Details for d6u7fa1

PDB Entry: 6u7f (more details), 2.75 Å

PDB Description: hcov-229e rbd class iv in complex with human apn
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d6u7fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u7fa1 b.98.1.0 (A:66-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihsk
klnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefege
laddlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdlta
lsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsef

SCOPe Domain Coordinates for d6u7fa1:

Click to download the PDB-style file with coordinates for d6u7fa1.
(The format of our PDB-style files is described here.)

Timeline for d6u7fa1: